PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P17290_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 552aa    MW: 61507.6 Da    PI: 4.8616
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P17290_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS439.13.1e-1341835522374
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                             ++lL++cA a+s++++e+aqa++++l++++s +gdp qRlaay++e+Laar+a+s+ +lykal+++e +   +s++l+a+++++ev+
  GSMUA_Achr10P17290_001 183 KHLLFDCAAAISQSSMEEAQAIITELRQMVSIQGDPPQRLAAYMVEGLAARIASSGRGLYKALKCKEPP---TSDRLSAMQILFEVC 266
                             699*****************************************************************9...9************** PP

                    GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelg 173
                             P++kf++++aN  I+eav+ e +vHiiDfd++qG Q+++L+q+L++ +++ p+lRi gv++pes+      l+ +g+rL+k+Ae lg
  GSMUA_Achr10P17290_001 267 PCFKFGYMAANYIIVEAVKDEAKVHIIDFDLNQGSQYINLIQTLSTWAGKRPQLRISGVDDPESVqrAVGGLKIIGHRLEKLAEDLG 353
                             ***************************************************************99878889**************** PP

                    GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                             vpfef++ +a ++ d+++e+L+++pgEal+Vn+++qlh+++desvs+ ++rd++L++vk+l Pk+v++veq++++n+++F+ rf+e 
  GSMUA_Achr10P17290_001 354 VPFEFRA-IAAKTGDITPEMLDCRPGEALVVNFAFQLHHMPDESVSTVNQRDQLLRMVKGLGPKLVTIVEQDMNTNTAPFFPRFVEV 439
                             *******.69999************************************************************************** PP

                    GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                              +yysa+fdsl+a+lpres +r++vEr++l+r+ivn+vacega+r+er e ++kWr+r+++aGF + p+s +++ ++++ll+ + ++
  GSMUA_Achr10P17290_001 440 YNYYSAVFDSLDATLPRESTDRMNVERQCLARDIVNIVACEGADRIERYEVAGKWRARMTMAGFVSCPFSANVNGSIQALLKSYCDR 526
                             *************************************************************************************66 PP

                    GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                              y+++ee g+l++gW+d++Lv++SaW+
  GSMUA_Achr10P17290_001 527 -YTIKEEIGALYFGWEDKNLVVASAWK 552
                             .*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.345156533IPR005202Transcription factor GRAS
PfamPF035141.1E-131183552IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MSVIRSADSS TAYGESNIYT RKGGGDSSAI SRQILSADEQ MYTYRPTSYH SGFYSQQYVT  60
NASSETVHAD PFHMSGSSIP RRYLQVSSAP YQLMANIHSS IISENPYKID YGEDEIRLKL  120
RELEQALLND NDEDLVDSDQ VMGIEDDWAE PIKDLLLPSS PKESSADSSV SCVGSNREPR  180
TPKHLLFDCA AAISQSSMEE AQAIITELRQ MVSIQGDPPQ RLAAYMVEGL AARIASSGRG  240
LYKALKCKEP PTSDRLSAMQ ILFEVCPCFK FGYMAANYII VEAVKDEAKV HIIDFDLNQG  300
SQYINLIQTL STWAGKRPQL RISGVDDPES VQRAVGGLKI IGHRLEKLAE DLGVPFEFRA  360
IAAKTGDITP EMLDCRPGEA LVVNFAFQLH HMPDESVSTV NQRDQLLRMV KGLGPKLVTI  420
VEQDMNTNTA PFFPRFVEVY NYYSAVFDSL DATLPRESTD RMNVERQCLA RDIVNIVACE  480
GADRIERYEV AGKWRARMTM AGFVSCPFSA NVNGSIQALL KSYCDRYTIK EEIGALYFGW  540
EDKNLVVASA WK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-5220155222375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380015.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLM0RJ040.0M0RJ04_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P17290_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1